Sequence details NCBI ID: XP_004852886.1 (Protein)

Details from NCBI annotation

Gene Symbol Sec11a
Protein Name PREDICTED: signal peptidase complex catalytic subunit SEC11A isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004852829.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004852829.1 (Coding sequence)

Sequence Protein

Length: 179 aa     
View alignmentsRaw sequence   
>XP_004852886.1
MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGMFVLVHRE