Sequence details NCBI ID: XP_004852680.1 (Protein)

Details from NCBI annotation

Gene Symbol Phlda2
Protein Name PREDICTED: pleckstrin homology-like domain family A member 2 [Heterocephalus glaber]

Database interlinks

Part of XM_004852623.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004852623.1 (Coding sequence)

Sequence Protein

Length: 131 aa     
View alignmentsRaw sequence   
>XP_004852680.1
MKTPSEVLREGELEKRSDSLFQLWKKKRGVLTPDRLRLFPAGPGARPKELRFHSILKVDCVERTGKYVYFTIVTTDRKEIDFRCAGESCWNAAITLALIDFQNRRALEGFRSRQERAVPAAQPEPRTARAP