Sequence details NCBI ID: XP_004852585.1 (Protein)

Details from NCBI annotation

Gene Symbol Fkbp2
Protein Name PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP2 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004852528.1 (Coding sequence)

There are 1 potential gene matches.

For more information consult the page for XM_004852528.1 (Coding sequence)

Sequence Protein

Length: 172 aa     
View alignmentsRaw sequence   
>XP_004852585.1
MREGGVARPVASRTRLRRGGSTSRVDSGGAARRNMRLSWVLTVLSICLSATATGSEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRSEL