Sequence details NCBI ID: XP_004852382.1 (Protein)

Details from NCBI annotation

Gene Symbol Cnih2
Protein Name PREDICTED: protein cornichon homolog 2 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004852325.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004852325.1 (Coding sequence)

Sequence Protein

Length: 160 aa     
View alignmentsRaw sequence   
>XP_004852382.1
MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF