Sequence details NCBI ID: XP_004852361.1 (Protein)

Details from NCBI annotation

Gene Symbol Mrpl11
Protein Name PREDICTED: 39S ribosomal protein L11, mitochondrial isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004852304.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004852304.1 (Coding sequence)

Sequence Protein

Length: 192 aa     
View alignmentsRaw sequence   
>XP_004852361.1
MSKLSRASRAVRKPEAGGLIRTIVRAGQAMPGPPLGPVLGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGMVTLKHIYEIACIKARDDAFALQDAPLSSVVRSIIGSARSLGIRVVKDLSAEELAAFQKERAEFLAAQREADLAAQAEAAKK