Sequence details NCBI ID: XP_004852148.1 (Protein)

Details from NCBI annotation

Gene Symbol Mrpl23
Protein Name PREDICTED: 39S ribosomal protein L23, mitochondrial isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004852091.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004852091.1 (Coding sequence)

Sequence Protein

Length: 152 aa     
View alignmentsRaw sequence   
>XP_004852148.1
MARNVLYPLYQLGGPQLRVFRTNFFIKLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLERIYNVPVAAVRTRVQHGSNRQRDYRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPETEPSLTDKELQSQSEFLEDVKQRQSSDPRRGGVSDWFGL