Sequence details NCBI ID: XP_004851653.1 (Protein)

Details from NCBI annotation

Gene Symbol Immp1l
Protein Name PREDICTED: mitochondrial inner membrane protease subunit 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004851596.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004851596.1 (Coding sequence)

Sequence Protein

Length: 166 aa     
View alignmentsRaw sequence   
>XP_004851653.1
MLRGALGKTFRLAGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFHGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKVLTTSPSDFFKSHSYVPTGHVWLEGDNLQNSTDSRFYGPIPYGLIRGRIFFKIWPLSDFGFLRDSPNGHRFSDN