Sequence details NCBI ID: XP_004851347.1 (Protein)

Details from NCBI annotation

Gene Symbol Mrps33
Protein Name PREDICTED: 28S ribosomal protein S33, mitochondrial isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004851290.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004851290.1 (Coding sequence)

Sequence Protein

Length: 106 aa     
View alignmentsRaw sequence   
>XP_004851347.1
MSSLSEYALRMSRLSARIFNEVASPTDSKSMKVVKLFSEQPVAKRKETYDWYPNHNTYFALMGTLRFLGLYRDEHQDFKDEQRRLKKLRGKGKPKKGEGKRAAKRK