Sequence details NCBI ID: XP_004851161.1 (Protein)

Details from NCBI annotation

Gene Symbol Vwc2l
Protein Name PREDICTED: von Willebrand factor C domain-containing protein 2-like [Heterocephalus glaber]

Database interlinks

Part of XM_004851104.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004851104.1 (Coding sequence)

Sequence Protein

Length: 222 aa     
View alignmentsRaw sequence   
>XP_004851161.1
MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQTSSNDNLIFDDYRGKGCVDDSGFVYKLGEQFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHGKNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAGTTIIPAGIEVKVDECNICHCHNGDWWKPAQCSKRECQGKQTV