Sequence details NCBI ID: XP_004851077.1 (Protein)

Details from NCBI annotation

Gene Symbol Ndufs5
Protein Name PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 isoform X5 [Heterocephalus glaber]

Database interlinks

Part of XM_004851020.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004851020.1 (Coding sequence)

Sequence Protein

Length: 106 aa     
Raw sequence   
>XP_004851077.1
MPFFDVQKRLGINLDRHMTIQSAEQPYKLASRCHAFEKEWLECAHGIGAIRAEKECKIEHDDLVECLLRQKTIQRMSMIKRQRAKLIKEGTYTPPPHHLGKEEPGP