Sequence details NCBI ID: XP_004851039.1 (Protein)

Details from NCBI annotation

Gene Symbol Meaf6
Protein Name PREDICTED: chromatin modification-related protein MEAF6 isoform X6 [Heterocephalus glaber]

Database interlinks

Part of XM_004850982.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004850982.1 (Coding sequence)

Sequence Protein

Length: 196 aa     
View alignmentsRaw sequence   
>XP_004851039.1
MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRAVSISQST