Sequence details NCBI ID: XP_004851008.1 (Protein)

Details from NCBI annotation

Gene Symbol Trappc3
Protein Name PREDICTED: trafficking protein particle complex subunit 3 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004850951.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004850951.1 (Coding sequence)

Sequence Protein

Length: 180 aa     
View alignmentsRaw sequence   
>XP_004851008.1
MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGYNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE