Sequence details NCBI ID: XP_004850989.1 (Protein)

Details from NCBI annotation

Gene Symbol Psmb2
Protein Name PREDICTED: proteasome subunit beta type-2 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004850932.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004850932.1 (Coding sequence)

Sequence Protein

Length: 201 aa     
View alignmentsRaw sequence   
>XP_004850989.1
MEYLIGIQGPDYVLVASDRVAASSIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS