Sequence details NCBI ID: XP_004850946.1 (Protein)

Details from NCBI annotation

Gene Symbol Hpca
Protein Name PREDICTED: neuron-specific calcium-binding protein hippocalcin isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004850889.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004850889.1 (Coding sequence)

Sequence Protein

Length: 193 aa     
View alignmentsRaw sequence   
>XP_004850946.1
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF