Sequence details NCBI ID: XP_004850828.1 (Protein)

Details from NCBI annotation

Gene Symbol Taf12
Protein Name PREDICTED: transcription initiation factor TFIID subunit 12 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004850771.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004850771.1 (Coding sequence)

Sequence Protein

Length: 161 aa     
View alignmentsRaw sequence   
>XP_004850828.1
MNQFGPSALINLSSFSSIKPEPASNPPQGPMANSTTVVKIPGTPGTGGRLSPESNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK