Sequence details NCBI ID: XP_004850700.1 (Protein)

Details from NCBI annotation

Gene Symbol Sh3bgrl3
Protein Name PREDICTED: SH3 domain-binding glutamic acid-rich-like protein 3 [Heterocephalus glaber]

Database interlinks

Part of XM_004850643.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004850643.1 (Coding sequence)

Sequence Protein

Length: 93 aa     
View alignmentsRaw sequence   
>XP_004850700.1
MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA