Sequence details NCBI ID: XP_004850517.1 (Protein)

Details from NCBI annotation

Gene Symbol Camk2n1
Protein Name PREDICTED: calcium/calmodulin-dependent protein kinase II inhibitor 1 [Heterocephalus glaber]

Database interlinks

Part of XM_004850460.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004850460.1 (Coding sequence)

Sequence Protein

Length: 78 aa     
View alignmentsRaw sequence   
>XP_004850517.1
MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV