Sequence details NCBI ID: XP_004850504.1 (Protein)

Details from NCBI annotation

Gene Symbol Nbl1
Protein Name PREDICTED: neuroblastoma suppressor of tumorigenicity 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004850447.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004850447.1 (Coding sequence)

Sequence Protein

Length: 188 aa     
Raw sequence   
>XP_004850504.1
MRSSRALEATGMMLRVLVGAILPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQTMWEIVTLECPGHEVMPRVDKLVEKILHCSCQACGKEPSHEGLNVYVQAEEGQGSLPGAHPHPQPGGQSPEPQETPGGPHVEEEGAED