Sequence details NCBI ID: XP_004850426.1 (Protein)

Details from NCBI annotation

Gene Symbol Szrd1
Protein Name PREDICTED: SUZ domain-containing protein 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004850369.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004850369.1 (Coding sequence)

Sequence Protein

Length: 151 aa     
View alignmentsRaw sequence   
>XP_004850426.1
MEDEEVAESWEEAADSGEIDRRLEKKLKITQKERKSKSPPKVPIVIQDDSLPTGPPPQIRILKRPTSNGVVSSPNSTSRPALPVKSLAQREAEYAEARKRILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPLGPDGSQGFKQRR