Sequence details NCBI ID: XP_004850258.1 (Protein)

Details from NCBI annotation

Gene Symbol Med30
Protein Name PREDICTED: mediator of RNA polymerase II transcription subunit 30 [Heterocephalus glaber]

Database interlinks

Part of XM_004850201.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004850201.1 (Coding sequence)

Sequence Protein

Length: 178 aa     
View alignmentsRaw sequence   
>XP_004850258.1
MSTPPLAASGMAPGPFSGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASDERREVAEVNKKLKQKNQQLKQIMDQLRNLIWDVNAMLAMRN