Sequence details NCBI ID: XP_004850237.1 (Protein)

Details from NCBI annotation

Gene Symbol Ebag9
Protein Name PREDICTED: receptor-binding cancer antigen expressed on SiSo cells isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004850180.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004850180.1 (Coding sequence)

Sequence Protein

Length: 213 aa     
View alignmentsRaw sequence   
>XP_004850237.1
MAITQFRLFKVCTCLAAVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGDGSAATQQNALEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGNPDGSTGFSSRLAATQDMPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKIADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS