Sequence details NCBI ID: XP_004850233.1 (Protein)

Details from NCBI annotation

Gene Symbol Eny2
Protein Name PREDICTED: enhancer of yellow 2 transcription factor homolog isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004850176.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004850176.1 (Coding sequence)

Sequence Protein

Length: 101 aa     
View alignmentsRaw sequence   
>XP_004850233.1
MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL