Sequence details NCBI ID: XP_004849911.1 (Protein)

Details from NCBI annotation

Gene Symbol Pradc1
Protein Name PREDICTED: protease-associated domain-containing protein 1 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004849854.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004849854.1 (Coding sequence)

Sequence Protein

Length: 188 aa     
View alignmentsRaw sequence   
>XP_004849911.1
MVPGAAGWWCLVLWLLACVAAHGLRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELRNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW