Sequence details NCBI ID: XP_004849769.1 (Protein)

Details from NCBI annotation

Gene Symbol Chic2
Protein Name PREDICTED: cysteine-rich hydrophobic domain 2 protein isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004849712.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004849712.1 (Coding sequence)

Sequence Protein

Length: 165 aa     
View alignmentsRaw sequence   
>XP_004849769.1
MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD