Sequence details NCBI ID: XP_004849608.1 (Protein)

Details from NCBI annotation

Gene Symbol Cdc26
Protein Name PREDICTED: anaphase-promoting complex subunit CDC26 isoform X11 [Heterocephalus glaber]

Database interlinks

Part of XM_004849551.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004849551.1 (Coding sequence)

Sequence Protein

Length: 85 aa     
View alignmentsRaw sequence   
>XP_004849608.1
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVDVIGGNDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSFEF