Sequence details NCBI ID: XP_004849596.1 (Protein)

Details from NCBI annotation

Gene Symbol Rnf183
Protein Name PREDICTED: RING finger protein 183 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004849539.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004849539.1 (Coding sequence)

Sequence Protein

Length: 192 aa     
View alignmentsRaw sequence   
>XP_004849596.1
MAEPQGRALEAECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTILASGQLVTDLPTDTAMLTLLHLEPHHIILEGRQLCLKDQPKSRYFLRQPRVYTLDFGPEPGSQTGSLQDTAPATGPRPIPIPSHYSPRECLRNPQFRIFAYLMAVILSVTLLLIFSIFWTKQFLWGVG