Sequence details NCBI ID: XP_004849490.1 (Protein)

Details from NCBI annotation

Gene Symbol Rbm18
Protein Name PREDICTED: probable RNA-binding protein 18 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004849433.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004849433.1 (Coding sequence)

Sequence Protein

Length: 190 aa     
View alignmentsRaw sequence   
>XP_004849490.1
MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQIKRYDHNKNDKILPISLEPSSSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTPYSRTAWKSRR