Sequence details NCBI ID: XP_004849354.1 (Protein)

Details from NCBI annotation

Gene Symbol Ak1
Protein Name PREDICTED: adenylate kinase isoenzyme 1 isoform X6 [Heterocephalus glaber]

Database interlinks

Part of XM_004849297.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004849297.1 (Coding sequence)

Sequence Protein

Length: 194 aa     
View alignmentsRaw sequence   
>XP_004849354.1
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRTEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVDSSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGSETMTKRLLKRGETSGRVDDNEETIKKRLDTYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFAQVCTHLDALK