Sequence details NCBI ID: XP_004849271.1 (Protein)

Details from NCBI annotation

Gene Symbol Urm1
Protein Name PREDICTED: ubiquitin-related modifier 1 homolog isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004849214.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004849214.1 (Coding sequence)

Sequence Protein

Length: 101 aa     
View alignmentsRaw sequence   
>XP_004849271.1
MAAPLSVEVEFGGGAELLFDGIKKHQVTLPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQNQDNILFISTLHGG