Sequence details NCBI ID: XP_004848235.1 (Protein)

Details from NCBI annotation

Gene Symbol Tal2
Protein Name PREDICTED: T-cell acute lymphocytic leukemia protein 2 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004848178.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004848178.1 (Coding sequence)

Sequence Protein

Length: 108 aa     
View alignmentsRaw sequence   
>XP_004848235.1
MTRKIFTNTRERWRQHNVNSAFAKLRELIPTHPPDKKLSKNETLRLAMRYINFLVKILGEQSLQQTGVAAQGNILGLFPQGPHLPGLESATVLNDYRVSSPGPSHHLP