Sequence details NCBI ID: XP_004848015.1 (Protein)

Details from NCBI annotation

Gene Symbol Cnep1r1
Protein Name PREDICTED: nuclear envelope phosphatase-regulatory subunit 1 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004847958.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004847958.1 (Coding sequence)

Sequence Protein

Length: 125 aa     
View alignmentsRaw sequence   
>XP_004848015.1
MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSFFTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTILAEYNMSCDDTGKLILKPRPHVQ