Sequence details NCBI ID: XP_004847858.1 (Protein)

Details from NCBI annotation

Gene Symbol Dusp22
Protein Name PREDICTED: dual specificity protein phosphatase 22 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004847801.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004847801.1 (Coding sequence)

Sequence Protein

Length: 204 aa     
View alignmentsRaw sequence   
>XP_004847858.1
MGNGMNKILPGLYIGNFKDARDVEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIEFIHECRLRGEGCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNLGFQRQLQEFEKHEVQQYRQWLKEEYGENPLQDAEEAKSILGKYKEQGRVDPQPGSRRWSSFSALPPLAYNYSTET