Sequence details NCBI ID: XP_004847820.1 (Protein)

Details from NCBI annotation

Gene Symbol Psmg4
Protein Name PREDICTED: proteasome assembly chaperone 4 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004847763.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004847763.1 (Coding sequence)

Sequence Protein

Length: 148 aa     
View alignmentsRaw sequence   
>XP_004847820.1
MEEPRAAAGGDVSVHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDPIPVCTSLLGDTSDTAPTGLAQRLGRWPGGPLSRATRRGGCGQSWHGAAVCWAVCNARCAEFPPPQASVFPLAVSTSTFPSCPRGGESD