Sequence details NCBI ID: XP_004847808.1 (Protein)

Details from NCBI annotation

Gene Symbol Lyrm4
Protein Name PREDICTED: LYR motif-containing protein 4 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004847751.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004847751.1 (Coding sequence)

Sequence Protein

Length: 91 aa     
View alignmentsRaw sequence   
>XP_004847808.1
MAASSRAQVLDLYRAMLRESKRFSAYNYRTYAIRRIRDAFRENKNVKDPVEIQTLVNKARRDLGIIRRQVHISHLYSTDKLVIENQEKPRT