Sequence details NCBI ID: XP_004847291.1 (Protein)

Details from NCBI annotation

Gene Symbol Med28
Protein Name PREDICTED: mediator of RNA polymerase II transcription subunit 28 [Heterocephalus glaber]

Database interlinks

Part of XM_004847234.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004847234.1 (Coding sequence)

Sequence Protein

Length: 178 aa     
View alignmentsRaw sequence   
>XP_004847291.1
MAAPLGGMFSGQPPGPSGAPPGHPGQASLLQATPGAPRSANSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPTEIPQGSLAYLEQASANIPAPLKQT