Sequence details NCBI ID: XP_004847173.1 (Protein)

Details from NCBI annotation

Gene Symbol Ppp1r11
Protein Name PREDICTED: protein phosphatase 1 regulatory subunit 11-like [Heterocephalus glaber]

Database interlinks

Part of XM_004847116.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004847116.1 (Coding sequence)

Sequence Protein

Length: 126 aa     
View alignmentsRaw sequence   
>XP_004847173.1
MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESEEEEEEGCGHTHCVRGHRKGQHHATPGRTPTTPPQPPDPSQPPPGPMQH