Sequence details NCBI ID: XP_004846535.1 (Protein)

Details from NCBI annotation

Gene Symbol Mrps18a
Protein Name PREDICTED: 28S ribosomal protein S18a, mitochondrial isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004846478.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004846478.1 (Coding sequence)

Sequence Protein

Length: 196 aa     
View alignmentsRaw sequence   
>XP_004846535.1
MAVLASLLSGCGRLFRGLLARSAAASWAQLPARGFREVVETQEGKTTIIEGRIVATPKESPNPPNPEGQCPICRWNLKHKYSYKDVLLLSQFLRPHGGMLPRRVTGLCTEEHRKVEECVKMAHRAGLLPDHRPLLPEGSIPKSRPKLNRYLTRWSPHSVKPIYKKGPRWKKVRMAVGSPLLKDNICYSVRPLKLYH