Sequence details NCBI ID: XP_004846528.1 (Protein)

Details from NCBI annotation

Gene Symbol Mrpl14
Protein Name PREDICTED: 39S ribosomal protein L14, mitochondrial isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004846471.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004846471.1 (Coding sequence)

Sequence Protein

Length: 145 aa     
View alignmentsRaw sequence   
>XP_004846528.1
MAASPALCGPLACVIRALGWHAFSTTGSIDAIQKLTRVRVVDNSALGNTPYHRPPRCIHVYNKSGVGKVGDRILLAIRGQKKKALIVGHRMPGPRMTPRFDSNNVVLIEDNGNPVGTRIKVPVPTSLRRKEGEYSKVLAIAQNFV