Sequence details NCBI ID: XP_004846328.1 (Protein)

Details from NCBI annotation

Gene Symbol Mrps16
Protein Name PREDICTED: 28S ribosomal protein S16, mitochondrial isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004846271.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004846271.1 (Coding sequence)

Sequence Protein

Length: 135 aa     
View alignmentsRaw sequence   
>XP_004846328.1
MVQLTTTLCKAYHGGHLTIRLALGGCANRPFYRIVAAHNKGPRDGRFVEQVGSYDPLPNSHGEKLVALNLERIRHWIGCGAHLSKPMEKLLGLSGFFPLHPMMITNAERLRRKRARAVLLASQKTNTEATETEAS