Sequence details NCBI ID: XP_004846315.1 (Protein)

Details from NCBI annotation

Gene Symbol Pla2g12b
Protein Name PREDICTED: group XIIB secretory phospholipase A2-like protein isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004846258.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004846258.1 (Coding sequence)

Sequence Protein

Length: 195 aa     
View alignmentsRaw sequence   
>XP_004846315.1
MKLATGFLILWLSLGGGLAQSDPGPEAEESFSDWGLRHLRGSFESVNSYFDSFQELLGGKNGICQYRCRYGKAPMPRPGYKPQEPNGCSSYFLGLKVPERMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEAACDSLADTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL