Sequence details NCBI ID: XP_004846168.1 (Protein)

Details from NCBI annotation

Gene Symbol Ptp4a1
Protein Name PREDICTED: protein tyrosine phosphatase type IVA 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004846111.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004846111.1 (Coding sequence)

Sequence Protein

Length: 173 aa     
Raw sequence   
>XP_004846168.1
MARMNRPAPVEVTYKSMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVFDWPFDDGAPPSNQIVDDWLNLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCMQ