Sequence details NCBI ID: XP_004846114.1 (Protein)

Details from NCBI annotation

Gene Symbol Abracl
Protein Name PREDICTED: costars family protein ABRACL isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004846057.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004846057.1 (Coding sequence)

Sequence Protein

Length: 81 aa     
View alignmentsRaw sequence   
>XP_004846114.1
MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD