Sequence details NCBI ID: XP_004845939.1 (Protein)

Details from NCBI annotation

Gene Symbol Clec9a
Protein Name PREDICTED: C-type lectin domain family 9 member A isoform X6 [Heterocephalus glaber]

Database interlinks

Part of XM_004845882.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004845882.1 (Coding sequence)

Sequence Protein

Length: 195 aa     
View alignmentsRaw sequence   
>XP_004845939.1
MQDEDGYITLNIKPQKPAPSSAVTQQNNLQAEKENLSGTVQNLAKNFCQHIIQQLEENQKRNHKCSPCDTNWRYHGDSCYGFFRHNLTWEESKRYCSNRNATLTKTASKNILDYIKDRTVFIRWVGLSRQNADKVWMWDDGSVLSKNMLEFFEDGGENMDCAYFHKGKIYPTFCKNRHYLMCERKAGMTNVDQLL