Sequence details NCBI ID: XP_004845883.1 (Protein)

Details from NCBI annotation

Gene Symbol unclassified transcription discrepancy
Protein Name PREDICTED: LOW QUALITY PROTEIN: retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma [Heterocephalus glaber]

Database interlinks

Part of XM_004845826.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004845826.1 (Coding sequence)

Sequence Protein

Length: 83 aa     
View alignmentsRaw sequence   
>XP_004845883.1
MNDNATLATPAPSQGPTTPHKGPPKFKQRXTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGII