Sequence details NCBI ID: XP_004845689.1 (Protein)

Details from NCBI annotation

Gene Symbol Polr2f
Protein Name PREDICTED: DNA-directed RNA polymerases I, II, and III subunit RPABC2 [Heterocephalus glaber]

Database interlinks

Part of XM_004845632.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004845632.1 (Coding sequence)

Sequence Protein

Length: 127 aa     
View alignmentsRaw sequence   
>XP_004845689.1
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD