Sequence details NCBI ID: XP_004845658.1 (Protein)

Details from NCBI annotation

Gene Symbol Cby1
Protein Name PREDICTED: protein chibby homolog 1 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004845601.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004845601.1 (Coding sequence)

Sequence Protein

Length: 127 aa     
View alignmentsRaw sequence   
>XP_004845658.1
MPLFGNIFSPKKTPPRKSASLSNLQTLDRSIRDVELGLNYGTPTMNLAGQSLKFEKGQWIAEAGVSGGVDQREAQRLRRRNQQLEEENNLLRLKVDILLDMLSETTAECHLMEKELDELKNVSRRRK