Sequence details NCBI ID: XP_004845619.1 (Protein)

Details from NCBI annotation

Gene Symbol Grap2
Protein Name PREDICTED: GRB2-related adapter protein 2 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004845562.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004845562.1 (Coding sequence)

Sequence Protein

Length: 327 aa     
View alignmentsRaw sequence   
>XP_004845619.1
MEAVAKFDFMASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPEWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISKQKQIFLRDRTREDQGHRGNSLDRRPQESPHLSGAVGEEIRPSMNRKLSDHPPPPPSQSHQHQQLPQHFTPGPQPLPQQRYLHHQHFNQDRRGGSLDINDRHCGMGVGSEMSAVLMHRRHTDPVQLQVAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSTNPSWWTGRLNNKLGLFPANYVAPMMR