Sequence details NCBI ID: XP_004845538.1 (Protein)

Details from NCBI annotation

Gene Symbol Smdt1
Protein Name PREDICTED: single-pass membrane protein with aspartate-rich tail 1, mitochondrial [Heterocephalus glaber]

Database interlinks

Part of XM_004845481.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004845481.1 (Coding sequence)

Sequence Protein

Length: 146 aa     
View alignmentsRaw sequence   
>XP_004845538.1
MGFSCACTTSRDLGWRPKGRRRQGWAARCAFPGEGRSWEMASGGARWLLLAPLRFGALRSGPRLRKGGDVPAVRDGSSRSLVPSRSVIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD