Sequence details NCBI ID: XP_004845446.1 (Protein)

Details from NCBI annotation

Gene Symbol Cdpf1
Protein Name PREDICTED: cysteine-rich DPF motif domain-containing protein 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004845389.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004845389.1 (Coding sequence)

Sequence Protein

Length: 124 aa     
Raw sequence   
>XP_004845446.1
MTSEAERSPLGVFECQLCALTAPYSYVGQKPPNTQSVLLLEESYIMKDPFSPDRGRFLVLGAQCSVCSRLVCVGPECSLFYSKRFCLPCVQKNLSAFPPEIQQDLEKRKAPSSKRPLGRACPGT