Sequence details NCBI ID: XP_004845027.1 (Protein)

Details from NCBI annotation

Gene Symbol Nudt4
Protein Name PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004844970.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004844970.1 (Coding sequence)

Sequence Protein

Length: 180 aa     
View alignmentsRaw sequence   
>XP_004845027.1
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAEREVYEEAGVRGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPTNGNSTVPSLPDNNALFVTAAQSPGLPSSVR